PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005707P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 365aa    MW: 41302.3 Da    PI: 6.5651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005707P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
   MELO3C005707P1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding43.57.1e-1467112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH.HHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck.srwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k ++w+++
   MELO3C005707P1  67 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKkNYWNSW 112
                      89********************.*********.*******64788876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25664IPR009057Homeodomain-like
PROSITE profilePS5129423.67965IPR017930Myb domain
SuperFamilySSF466891.91E-2811108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001674.76E-111761No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2265117IPR009057Homeodomain-like
PROSITE profilePS5129417.85666117IPR017930Myb domain
SMARTSM007171.8E-1266115IPR001005SANT/Myb domain
PfamPF002491.6E-1267112IPR001005SANT/Myb domain
CDDcd001677.28E-1069113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKKNYWN SWIKKKIRKP  120
NSTTPTISAT TTVTSTTNTT EQIQLSSNPH QLNFLTQDLT TKQLSLHQET LFPALSCPLF  180
MFDTSSQELF HDYSLSLNSD TTWHMNHHNH PFPTAVLSPQ MGLTTASTTV MNNTNNYLPP  240
LIENIESLVT MEDEGEMALQ CLQRQELNEW VVESTTQPQN SNFLFWENVE GSLGGEEIIA  300
PSSNATIGGG GGANTLSSSN FPYXXXXXXX XXXXXXXXXX XXXXXXXXXX XXSLLFLLDC  360
LLCK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011654724.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0A0KMI20.0A0A0A0KMI2_CUCSA; Uncharacterized protein
STRINGPOPTR_0003s13190.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.13e-95myb domain protein 103